PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 240aa    MW: 28760.5 Da    PI: 7.8528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591214.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.8e-181158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEde+lv+ v++lG ++W++ ar  g++R++k+c++rw +yl
   XP_013591214.1 11 RGPWLEEEDERLVKFVTLLGERRWDSLARVSGLKRSGKSCRLRWMNYL 58
                     89********************************************97 PP

2Myb_DNA-binding50.74e-1665107246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+ ++eE+ ++ ++++++G++ W++Iar+++ gRt++q+k++w++
   XP_013591214.1  65 GPLSQEEEIIIFQLHALWGNK-WSKIARRLP-GRTDNQIKNYWRT 107
                      5679*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.733658IPR017930Myb domain
SuperFamilySSF466897.59E-289105IPR009057Homeodomain-like
SMARTSM007171.1E-131060IPR001005SANT/Myb domain
PfamPF002491.5E-141158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-181265IPR009057Homeodomain-like
CDDcd001672.40E-81358No hitNo description
PROSITE profilePS5129425.43259113IPR017930Myb domain
SMARTSM007174.6E-1563111IPR001005SANT/Myb domain
PfamPF002491.7E-1465107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2466113IPR009057Homeodomain-like
CDDcd001672.81E-968109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDCKKEEALR RGPWLEEEDE RLVKFVTLLG ERRWDSLARV SGLKRSGKSC RLRWMNYLNP  60
SLKCGPLSQE EEIIIFQLHA LWGNKWSKIA RRLPGRTDNQ IKNYWRTRLR KKVEAQNYDK  120
IIDWRGNKGE ELLHKYKETE IMWTRMKTRE YGFDETVKEY KQRNMENDKE TNGVICETER  180
FGVTNSPYEN RIIDWISKSD ANLLEDHSSS STDNNININV GSWWFQEIMD FEEFSCSLWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-2991132105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1172561e-138AK117256.1 Arabidopsis thaliana At3g53200 mRNA for putative transcription factor (MYB27), complete cds, clone: RAFL16-81-D10.
GenBankAY5195991e-138AY519599.1 Arabidopsis thaliana MYB transcription factor (At3g53200) mRNA, complete cds.
GenBankBT0052571e-138BT005257.1 Arabidopsis thaliana At3g53200 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591214.11e-177PREDICTED: transcription factor MYB21-like
TrEMBLA0A0D3CTJ71e-177A0A0D3CTJ7_BRAOL; Uncharacterized protein
STRINGBra028550.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.11e-119myb domain protein 27